Host taxon 9606
Protein NP_005013.1
profilin-1 isoform 2
Homo sapiens
Gene PFN1, UniProt P07737
>NP_005013.1|Haemophilus ducreyi 35000HP|profilin-1 isoform 2
MAGWNAYIDNLMADGTCQDAAIVGYKDSPSVWAAVPGKTFVNITPAEVGVLVGKDRSSFYVNGLTLGGQKCSVIRDSLLQDGEFSMDLRTKSTGGAPTFNVTVTKTDKTLVLLMGKEGVHGGLINKKCYEMASHLRRSQY
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●●○○ 2.24 | 2.24275638150576 | 9.7e-9 | 31213562 | |
Retrieved 1 of 1 entries in 1.1 ms
(Link to these results)