Host taxon 9606
Protein NP_001008271.2
probable inactive serine protease 37 isoform 1 precursor
Homo sapiens
Gene PRSS37, UniProt A4D1T9
>NP_001008271.2|Haemophilus ducreyi 35000HP|probable inactive serine protease 37 isoform 1 precursor
MKYVFYLGVLAGTFFFADSSVQKEDPAPYLVYLKSHFNPCVGVLIKPSWVLAPAHCYLPNLKVMLGNFKSRVRDGTEQTINPIQIVRYWNYSHSAPQDDLMLIKLAKPAMLNPKVQPLTLATTNVRPGTVCLLSGLDWSQENSGRHPDLRQNLEAPVMSDRECQKTEQGKSHRNSLCVKFVKVFSRIFGEVAVATVICKDKLQGIEVGHFMGGDVGIYTNVYKYVSWIENTAKDK
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●○○○ -1.15 | -1.14588873497633 | 0.0027 | 31213562 | |
Retrieved 1 of 1 entries in 1 ms
(Link to these results)