Host taxon 9606
Protein NP_002614.2
prefoldin subunit 4
Homo sapiens
Gene PFDN4, UniProt Q9NQP4
>NP_002614.2|Haemophilus ducreyi 35000HP|prefoldin subunit 4
MAATMKKAAAEDVNVTFEDQQKINKFARNTSRITELKEEIEVKKKQLQNLEDACDDIMLADDDCLMIPYQIGDVFISHSQEETQEMLEEAKKNLQEEIDALESRVESIQRVLADLKVQLYAKFGSNINLEADES
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●○○○○ 0.73 | 0.730456022255271 | 0.0001 | 31213562 | |
Retrieved 1 of 1 entries in 1.4 ms
(Link to these results)