Host taxon 9606
Protein NP_005463.1
potassium voltage-gated channel subfamily E member 3
Homo sapiens
Gene KCNE3, UniProt Q9Y6H6
>NP_005463.1|Haemophilus ducreyi 35000HP|potassium voltage-gated channel subfamily E member 3
METTNGTETWYESLHAVLKALNATLHSNLLCRPGPGLGPDNQTEERRASLPGRDDNSYMYILFVMFLFAVTVGSLILGYTRSRKVDKRSDPYHVYIKNRVSMI
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●○○○ 1.78 | 1.77573080794606 | 0.00023 | 31213562 | |
Retrieved 1 of 2 entries in 0.8 ms
(Link to these results)