Host taxon 9606
Protein NP_000210.2
potassium voltage-gated channel subfamily E member 1
Homo sapiens
Gene KCNE1, UniProt P15382
>NP_000210.2|Haemophilus ducreyi 35000HP|potassium voltage-gated channel subfamily E member 1
MILSNTTAVTPFLTKLWQETVQQGGNMSGLARRSPRSSDGKLEALYVLMVLGFFGFFTLGIMLSYIRSKKLEHSNDPFNVYIESDAWQEKDKAYVQARVLESYRSCYVVENHLAIEQPNTHLPETKPSP
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●●○○ 2 | 2.00421043094021 | 4.8e-5 | 31213562 | |
Retrieved 1 of 5 entries in 0.4 ms
(Link to these results)