Host taxon 9606
Protein NP_060519.1
pleckstrin homology domain-containing family J member 1 isoform 2
Homo sapiens
Gene PLEKHJ1, UniProt Q9NW61
>NP_060519.1|Haemophilus ducreyi 35000HP|pleckstrin homology domain-containing family J member 1 isoform 2
MRYNEKELQALSRQPAEMAAELGMRGPKKGSVLKRRLVKLVVNFLFYFRTDEAEPVGALLLERCRVVREEPGTFSISFIEDPERKYHFECSSEEQCQEWMEALRRASYEFMRRSLIFYRNEIRKVTGKDPLEQFGISEEARFQLSGLQA
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●○○○○ 0.77 | 0.769897668237115 | 0.011 | 31213562 | |
Retrieved 1 of 3 entries in 1.9 ms
(Link to these results)