Host taxon 9606
Protein NP_001094093.1
pleckstrin homology domain-containing family B member 2 isoform 3
Homo sapiens
Gene PLEKHB2, UniProt Q96CS7
>NP_001094093.1|Haemophilus ducreyi 35000HP|pleckstrin homology domain-containing family B member 2 isoform 3
MAFVKSGWLLRQSTILKRWKKNWFDLWSDGHLIYYDDQTRQNIEDKVHMPMDCINIRTGQECRDTQPPDGKSKDCMLQIVCRDGKTISLCAESTDDCLAWKFTLQDSRTNTAYVGSAVMTDETSVVSSPPPYTAYAAPAPEQAYGYGPYGGAYPPGTQVVYAANGQAYAVPYQYPYAGLYGQQPANQVIIRERYRDNDSDLALGMLAGAATGMALGSLFWVF
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●○○○ 1.14 | 1.14249754495772 | 7.8e-6 | 31213562 | |
Retrieved 1 of 4 entries in 0.7 ms
(Link to these results)