Host taxon 9606
Protein NP_002599.1
platelet-derived growth factor subunit B isoform 1 preproprotein
Homo sapiens
Gene PDGFB, UniProt P01127
>NP_002599.1|Haemophilus ducreyi 35000HP|platelet-derived growth factor subunit B isoform 1 preproprotein
MNRCWALFLSLCCYLRLVSAEGDPIPEELYEMLSDHSIRSFDDLQRLLHGDPGEEDGAELDLNMTRSHSGGELESLARGRRSLGSLTIAEPAMIAECKTRTEVFEISRRLIDRTNANFLVWPPCVEVQRCSGCCNNRNVQCRPTQVQLRPVQVRKIEIVRKKPIFKKATVTLEDHLACKCETVAAARPVTRSPGGSQEQRAKTPQTRVTIRTVRVRRPPKGKHRKFKHTHDKTALKETLGA
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●○○○○ 0.64 | 0.635936306957614 | 0.047 | 31213562 | |
Retrieved 1 of 1 entries in 2 ms
(Link to these results)