Host taxon 9606
Protein NP_057077.1
plasmolipin
Homo sapiens
Gene PLLP, UniProt Q9Y342
>NP_057077.1|Haemophilus ducreyi 35000HP|plasmolipin
MAEFPSKVSTRTSSPAQGAEASVSALRPDLGFVRSRLGALMLLQLVLGLLVWALIADTPYHLYPAYGWVMFVAVFLWLVTIVLFNLYLFQLHMKLYMVPWPLVLMIFNISATVLYITAFIACSAAVDLTSLRGTRPYNQRAAASFFACLVMIAYGVSAFFSYQAWRGVGSNAATSQMAGGYA
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●●○○ -2.34 | -2.34438545210121 | 8.0e-5 | 31213562 | |
Retrieved 1 of 2 entries in 0.8 ms
(Link to these results)