Host taxon 9606
Protein NP_001094346.1
phytanoyl-CoA dioxygenase domain-containing protein 1 isoform a
Homo sapiens
Gene PHYHD1, UniProt Q5SRE7
>NP_001094346.1|Haemophilus ducreyi 35000HP|phytanoyl-CoA dioxygenase domain-containing protein 1 isoform a
MACLSPSQLQKFQQDGFLVLEGFLSAEECVAMQQRIGEIVAEMDVPLHCRTEFSTQEEEQLRAQGSTDYFLSSGDKIRFFFEKGVFDEKGNFLVPPEKSINKIGHALHAHDPVFKSITHSFKVQTLARSLGLQMPVVVQSMYIFKQPHFGGEVSPHQDASFLYTEPLGRVLGVWIAVEDATLENGCLWFIPGSHTSGVSRRMVRAPVGSAPGTSFLGSEPARDNSLFVPTPVQRGALVLIHGEVVHKSKQNLSDRSRQAYTFHLMEASGTTWSPENWLQPTAELPFPQLYT
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●○○○○ -0.9 | -0.897991026809215 | 1.3e-5 | 31213562 | |
Retrieved 1 of 2 entries in 1.9 ms
(Link to these results)