Host taxon 9606
Protein NP_001071088.1
photoreceptor disk component PRCD precursor
Homo sapiens
Gene PRCD, UniProt Q00LT1
>NP_001071088.1|Haemophilus ducreyi 35000HP|photoreceptor disk component PRCD precursor
MCTTLFLLSTLAMLWRRRFANRVQPEPSDVDGAARGSSLDADPQSSGREKEPLK
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●○○○○ -0.9 | -0.904980344438205 | 0.0066 | 31213562 | |
Retrieved 1 of 1 entries in 0.8 ms
(Link to these results)