Host taxon 9606
Protein NP_001137456.1
phosphatidylglycerophosphatase and protein-tyrosine phosphatase 1 isoform 2
Homo sapiens
Gene PTPMT1, UniProt Q8WUK0
>NP_001137456.1|Haemophilus ducreyi 35000HP|phosphatidylglycerophosphatase and protein-tyrosine phosphatase 1 isoform 2
MAATALLEAGLARVLFYPTLLYTLFRGKVPGRAHRDWYHRIDPTVLLGALPLRSLTRQVSRAGEPGPLPRPRRSVPVGPLGSPPSLLSHLFASAAGTGRERARGDHHERGVRDEVPVQLFTGAQMESRGGCKSHRQDPVIHPHQAWPAGCS
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●○○○○ 0.71 | 0.709187837229781 | 0.00062 | 31213562 | |
Retrieved 1 of 1 entries in 0.8 ms
(Link to these results)