Host taxon 9606
Protein NP_066950.1
phorbol-12-myristate-13-acetate-induced protein 1
Homo sapiens
Gene PMAIP1, UniProt Q13794
>NP_066950.1|Haemophilus ducreyi 35000HP|phorbol-12-myristate-13-acetate-induced protein 1
MPGKKARKNAQPSPARAPAELEVECATQLRRFGDKLNFRQKLLNLISKLFCSGT
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●○○○ 1.14 | 1.13603406581448 | 0.007 | 31213562 | |
Retrieved 1 of 2 entries in 1 ms
(Link to these results)