Host taxon 9606
Protein NP_694535.2
peroxisomal testis-specific protein 1
Homo sapiens
Gene PXT1, UniProt Q8NFP0
>NP_694535.2|Haemophilus ducreyi 35000HP|peroxisomal testis-specific protein 1
MKKKHDGIVYETKEVLNPSPKVTHCCKSLWLKYSFQKAYMTQLVSSQPVPAMSRNPDHNLLSQPKEHSIVQKHHQEEIIHKLAMQLRHIGDNIDHRMVREDLQQDGRDALDHFVFFFFRRVQVLLHFFWNNHLL
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●○○○ 1.82 | 1.82220104702612 | 0.0023 | 31213562 | |
Retrieved 1 of 1 entries in 0.6 ms
(Link to these results)