Host taxon 9606
Protein NP_009169.3
peroxisomal membrane protein 4 isoform a
Homo sapiens
Gene PXMP4, UniProt Q9Y6I8
>NP_009169.3|Haemophilus ducreyi 35000HP|peroxisomal membrane protein 4 isoform a
MAAPPQLRALLVVVNALLRKRRYHAALAVLKGFRNGAVYGAKIRAPHALVMTFLFRNGSLQEKLWAILQATYIHSWNLARFVFTYKGLRALQSYIQGKTYPAHAFLAAFLGGILVFGENNNINSQINMYLLSRVLFALSRLAVEKGYIPEPRWDPFPLLTAVVWGLVLWLFEYHRSTLQPSLQSSMTYLYEDSNVWHDISDFLVYNKSRPSN
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●○○○ -1.88 | -1.88377940068426 | 0.00012 | 31213562 | |
Retrieved 1 of 1 entries in 0.7 ms
(Link to these results)