Host taxon 9606
Protein NP_001015509.1
peptidyl-tRNA hydrolase 2, mitochondrial isoform a
Homo sapiens
Gene PTRH2, UniProt Q9Y3E5
>NP_001015509.1|Haemophilus ducreyi 35000HP|peptidyl-tRNA hydrolase 2, mitochondrial isoform a
MMPSKSLVMEYLAHPSTLGLAVGVACGMCLGWSLRVCFGMLPKSKTSKTHTDTESEASILGDSGEYKMILVVRNDLKMGKGKVAAQCSHAAVSAYKQIQRRNPEMLKQWEYCGQPKVVVKAPDEETLIALLAHAKMLGLTVSLIQDAGRTQIAPGSQTVLGIGPGPADLIDKVTGHLKLY
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●○○○○ 0.47 | 0.4745482276693 | 0.001 | 31213562 | |
Retrieved 1 of 2 entries in 0.9 ms
(Link to these results)