Host taxon 9606
Protein NP_115861.1
peptidyl-prolyl cis-trans isomerase-like 3 isoform PPIL3a
Homo sapiens
Gene PPIL3, UniProt Q9H2H8
>NP_115861.1|Haemophilus ducreyi 35000HP|peptidyl-prolyl cis-trans isomerase-like 3 isoform PPIL3a
MSVTLHTDVGDIKIEVFCERTPKTCEMESRCVPQAGVQWRDLGSLQPPPPGFKQVFCLSLPRTGRGGNSIWGKKFEDEYSEYLKHNVRGVVSMANNGPNTNGSQFFITYGKQPHLDMKYTVFGKVIDGLETLDELEKLPVNEKTYRPLNDVHIKDITIHANPFAQ
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●○○○○ 0.47 | 0.470371322116606 | 0.0016 | 31213562 | |
Retrieved 1 of 3 entries in 1.1 ms
(Link to these results)