Host taxon 9606
Protein NP_001137253.1
peptidyl-prolyl cis-trans isomerase FKBP11 isoform 2
Homo sapiens
Gene FKBP11, UniProt Q9NYL4
>NP_001137253.1|Haemophilus ducreyi 35000HP|peptidyl-prolyl cis-trans isomerase FKBP11 isoform 2
MCVGEKRRAIIPSHLAYGKRGFPPSVPADAVVQYDVELIALIRANYWLKLVKGILPLVGMAMVPALLGLIGYHLYRKANRPKVSKKKLKEEKRNKSKKK
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●○○○ 1.35 | 1.34822577524883 | 3.1e-6 | 31213562 | |
Retrieved 1 of 2 entries in 0.7 ms
(Link to these results)