Host taxon 9606
Protein NP_005720.1
peptidyl-prolyl cis-trans isomerase F, mitochondrial precursor
Homo sapiens
Gene PPIF, UniProt P30405
>NP_005720.1|Haemophilus ducreyi 35000HP|peptidyl-prolyl cis-trans isomerase F, mitochondrial precursor
MLALRCGSRWLGLLSVPRSVPLRLPAARACSKGSGDPSSSSSSGNPLVYLDVDANGKPLGRVVLELKADVVPKTAENFRALCTGEKGFGYKGSTFHRVIPSFMCQAGDFTNHNGTGGKSIYGSRFPDENFTLKHVGPGVLSMANAGPNTNGSQFFICTIKTDWLDGKHVVFGHVKEGMDVVKKIESFGSKSGRTSKKIVITDCGQLS
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●●○○ 2.27 | 2.26519173856757 | 2.3e-5 | 31213562 | |
Retrieved 1 of 2 entries in 0.8 ms
(Link to these results)