Host taxon 9606
Protein NP_005755.1
PDZK1-interacting protein 1 precursor
Homo sapiens
Gene PDZK1IP1, UniProt Q13113
>NP_005755.1|Haemophilus ducreyi 35000HP|PDZK1-interacting protein 1 precursor
MSALSLLILGLLTAVPPASCQQGLGNLQPWMQGLIAVAVFLVLVAIAFAVNHFWCQEEPEPAHMILTVGNKADGVLVGTDGRYSSMAASFRSSEHENAYENVPEEEGKVRSTPM
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●●○○ 2.39 | 2.3864114394293 | 7.0e-6 | 31213562 | |
Retrieved 1 of 1 entries in 0.9 ms
(Link to these results)