Host taxon 9606
Protein NP_057568.1
PDZ domain-containing protein 11 isoform 1
Homo sapiens
Gene PDZD11, UniProt Q5EBL8
>NP_057568.1|Haemophilus ducreyi 35000HP|PDZ domain-containing protein 11 isoform 1
MDSRIPYDDYPVVFLPAYENPPAWIPPHERVHHPDYNNELTQFLPRTITLKKPPGAQLGFNIRGGKASQLGIFISKVIPDSDAHRAGLQEGDQVLAVNDVDFQDIEHSKAVEILKTAREISMRVRFFPYNYHRQKERTVH
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●○○○○ 0.7 | 0.696755025256478 | 0.00042 | 31213562 | |
Retrieved 1 of 1 entries in 1.9 ms
(Link to these results)