Host taxon 9606
Protein NP_001182123.1
p53-regulated apoptosis-inducing protein 1 isoform c
Homo sapiens
Gene TP53AIP1, UniProt Q9HCN2
>NP_001182123.1|Haemophilus ducreyi 35000HP|p53-regulated apoptosis-inducing protein 1 isoform c
MGSSSEASFRSAQASCSGARRQGLGRGDQNLSVMPPNGRAQTHTPGWVSDPLVLGAQVHGGCRGIEALSVSSGSWSSATVWILTGLSRPFLPGATVLRDRPLGSAFELSYDQKKAPLRLQ
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●●○○ -2.14 | -2.13764498197251 | 8.5e-6 | 31213562 | |
Retrieved 1 of 1 entries in 0.7 ms
(Link to these results)