Host taxon 9606
Protein NP_001034931.1
oxidoreductase-like domain-containing protein 1 isoform a
Homo sapiens
Gene OXLD1, UniProt Q5BKU9
>NP_001034931.1|Haemophilus ducreyi 35000HP|oxidoreductase-like domain-containing protein 1 isoform a
MLLRRVVEGGRAVAAAVRGSGARRFSSPDCCQRLPGGGSFLQRHHPGAQAPDGRRKFGTDHVEVGSQAGADGTRPPKASLPPELQPPTNCCMSGCPNCVWVEYADRLLQHFQDGGERALAALEEHVADENLKAFLRMEIRLHTRCGG
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●○○○○ 0.73 | 0.733940033798935 | 0.00099 | 31213562 | |
Retrieved 1 of 2 entries in 1.6 ms
(Link to these results)