Host taxon 9606
Protein NP_001254746.1
oligosaccharyltransferase complex subunit OSTC isoform 2
Homo sapiens
Gene OSTC, UniProt Q9NRP0
>NP_001254746.1|Haemophilus ducreyi 35000HP|oligosaccharyltransferase complex subunit OSTC isoform 2
METLYRVPFLVLECPNLKLKKPPWLHMPSAMTVYALVVVSYFLITGGIIYDVIVEPPSVGSMTDEHGHQRPVAFLAYRGYLMG
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●○○○ 1.47 | 1.46526149613726 | 4.5e-9 | 31213562 | |
Retrieved 1 of 2 entries in 0.7 ms
(Link to these results)