Host taxon 9606
Protein NP_001273362.1
nucleoside diphosphate kinase, mitochondrial isoform b
Homo sapiens
Gene NME4, UniProt O00746
>NP_001273362.1|Haemophilus ducreyi 35000HP|nucleoside diphosphate kinase, mitochondrial isoform b
MGGLFWRSALRGLRCGPRAPGPSLLVRHGSGGPSWTRERTLVAVKPDGVQRRLVGDVIQRFERRGFTLVGMKMLQVWEGYNVVRASRAMIGHTDSAEAAPGTIRGDFSVHISRNVIHASDSVEGAQREIQLWFQSSELVSWADGGQHSSIHPA
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●○○○○ 0.71 | 0.708129038836368 | 0.036 | 31213562 | |
Retrieved 1 of 2 entries in 0.8 ms
(Link to these results)