Host taxon 9606
Protein NP_002704.1
nuclear inhibitor of protein phosphatase 1 isoform gamma
Homo sapiens
Gene PPP1R8, UniProt Q12972
>NP_002704.1|Haemophilus ducreyi 35000HP|nuclear inhibitor of protein phosphatase 1 isoform gamma
MVQTAVVPVKKKRVEGPGSLGLEESGSRRMQNFAFSGGLYGGLPPTHSEAGSQPHGIHGTALIGGLPMPYPNLAPDVDLTPVVPSAVNMNPAPNPAVYNPEAVNEPKKKKYAKEAWPGKKPTPSLLI
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●○○○○ 0.57 | 0.567618676000121 | 0.012 | 31213562 | |
Retrieved 1 of 2 entries in 0.6 ms
(Link to these results)