Host taxon 9606
Protein NP_037380.1
NTF2-related export protein 1
Homo sapiens
Gene NXT1, UniProt Q9UKK6
>NP_037380.1|Haemophilus ducreyi 35000HP|NTF2-related export protein 1
MASVDFKTYVDQACRAAEEFVNVYYTTMDKRRRLLSRLYMGTATLVWNGNAVSGQESLSEFFEMLPSSEFQISVVDCQPVHDEATPSQTTVLVVICGSVKFEGNKQRDFNQNFILTAQASPSNTVWKIASDCFRFQDWAS
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●○○○ 1.31 | 1.30949994697651 | 1.1e-5 | 31213562 | |
Retrieved 1 of 1 entries in 0.8 ms
(Link to these results)