Host taxon 9606
Protein NP_006423.1
NPC intracellular cholesterol transporter 2 isoform 2 precursor
Homo sapiens
Gene NPC2, UniProt P61916
>NP_006423.1|Haemophilus ducreyi 35000HP|NPC intracellular cholesterol transporter 2 isoform 2 precursor
MRFLAATFLLLALSTAAQAEPVQFKDCGSVDGVIKEVNVSPCPTQPCQLSKGQSYSVNVTFTSNIQSKSSKAVVHGILMGVPVPFPIPEPDGCKSGINCPIQKDKTYSYLNKLPVKSEYPSIKLVVEWQLQDDKNQSLFCWEIPVQIVSHL
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●○○○ 1.79 | 1.7850732045355 | 6.9e-9 | 31213562 | |
Retrieved 1 of 3 entries in 1 ms
(Link to these results)