Host taxon 9606
Protein NP_982283.2
notch homolog 2 N-terminal-like protein A isoform 1
Homo sapiens
Gene NOTCH2NLA, UniProt Q7Z3S9
>NP_982283.2|Haemophilus ducreyi 35000HP|notch homolog 2 N-terminal-like protein A isoform 1
MCVTYHNGTGYCKCPEGFLGEYCQHRDPCEKNRCQNGGTCVAQAMLGKATCRCASGFTGEDCQYSTSHPCFVSRPCLNGGTCHMLSRDTYECTCQVGFTGKECQWTDACLSHPCANGSTCTTVANQFSCKCLTGFTGQKCETDVNECDIPGHCQHGGTCLNLPGSYQCQCLQGFTGQYCDSLYVPCAPSPCVNGGTCRQTGDFTFECNCLPETVRRGTELWERDREVWNGKEHDEN
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●○○○○ -0.43 | -0.429642759967578 | 0.032 | 31213562 | |
Retrieved 1 of 1 entries in 0.7 ms
(Link to these results)