Host taxon 9606
Protein NP_001010980.1
noncompact myelin-associated protein
Homo sapiens
Gene NCMAP, UniProt Q5T1S8
>NP_001010980.1|Haemophilus ducreyi 35000HP|noncompact myelin-associated protein
MTTATPLGDTTFFSLNMTTRGEDFLYKSSGAIVAAVVVVVIIIFTVVLILLKMYNRKMRTRRELEPKGPKPTAPSAVGPNSNGSQHPATVTFSPVDVQVETR
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●○○○ -1.03 | -1.02964125817412 | 0.016 | 31213562 | |
Retrieved 1 of 1 entries in 1 ms
(Link to these results)