Host taxon 9606
Protein NP_004956.5
non-histone chromosomal protein HMG-14
Homo sapiens
Gene HMGN1, UniProt P05114
>NP_004956.5|Haemophilus ducreyi 35000HP|non-histone chromosomal protein HMG-14
MPKRKVSSAEGAAKEEPKRRSARLSAKPPAKVEAKPKKAAAKDKSSDKKVQTKGKRGAKGKQAEVANQETKEDLPAENGETKTEESPASDEAGEKEAKSD
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●○○○ 1.03 | 1.02722293289505 | 1.9e-7 | 31213562 | |
Retrieved 1 of 2 entries in 1.3 ms
(Link to these results)