Bacterial taxon 233412
Protein WP_010945538.1
non-heme ferritin
Haemophilus ducreyi 35000HP
Gene ftnA, UniProt Q7VKV8
>WP_010945538.1|Haemophilus ducreyi 35000HP|non-heme ferritin
MLQQAIVDKLNEQINLEFYSSNLYLQMSAWCSKNGFEGAAHFLLSHADEELAHMQKLFNYVSETGSLPILGKIDAPQADYPSLKALFDMVLTHEKHVTAKINELVEATSAAKDYSTFNFLQWYVAEQHEEEKLFSEILDKFSVAGEGKKSLYFIDKDLEELEQSQGAA
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | pathogen | Skin tissue | 6-8 days | ●●○○○ -1.53 | -1.52925108480811 | 4.3e-5 | 31213562 | Bacterial control measured at mid-exponential growth phase |
Retrieved 1 of 1 entries in 1.7 ms
(Link to these results)