Host taxon 9606
Protein NP_001186976.1
nicotinamide/nicotinic acid mononucleotide adenylyltransferase 3 isoform 2
Homo sapiens
Gene NMNAT3, UniProt Q96T66
>NP_001186976.1|Haemophilus ducreyi 35000HP|nicotinamide/nicotinic acid mononucleotide adenylyltransferase 3 isoform 2
MKSRIPVVLLACGSFNPITNMHLRMFEVARDHLHQTAVPELKLLCGADVLKTFQTPNLWKDAHIQEIVEKFGLVCVGRVGHDPKGYIAESPILRMHQHNIHLAKEPVQNEISATYIRRALGQGQSVKYLIPDAVITYIKDHGLYTKGSTWKGKSTQSTEGKTS
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●○○○ -1.24 | -1.23653700998192 | 0.019 | 31213562 | |
Retrieved 1 of 2 entries in 1.2 ms
(Link to these results)