Host taxon 9606
Protein NP_001001349.1
NF-kappa-B inhibitor-interacting Ras-like protein 2 isoform a
Homo sapiens
Gene NKIRAS2, UniProt Q9NYR9
>NP_001001349.1|Haemophilus ducreyi 35000HP|NF-kappa-B inhibitor-interacting Ras-like protein 2 isoform a
MGKSCKVVVCGQASVGKTSILEQLLYGNHVVGSEMIETQEDIYVGSIETDRGVREQVRFYDTRGLRDGAELPRHCFSCTDGYVLVYSTDSRESFQRVELLKKEIDKSKDKKEVTIVVLGNKCDLQEQRRVDPDVAQHWAKSEKVKLWEVSVADRRSLLEPFVYLASKMTQPQSKSAFPLSRKNKGSGSLDG
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●○○○○ 0.56 | 0.556641317813321 | 0.043 | 31213562 | |
Retrieved 1 of 2 entries in 1.7 ms
(Link to these results)