Host taxon 9606
Protein NP_002134.2
neuron-specific calcium-binding protein hippocalcin
Homo sapiens
Gene HPCA, UniProt P84074
>NP_002134.2|Haemophilus ducreyi 35000HP|neuron-specific calcium-binding protein hippocalcin
MGKQNSKLRPEMLQDLRENTEFSELELQEWYKGFLKDCPTGILNVDEFKKIYANFFPYGDASKFAEHVFRTFDTNSDGTIDFREFIIALSVTSRGRLEQKLMWAFSMYDLDGNGYISREEMLEIVQAIYKMVSSVMKMPEDESTPEKRTEKIFRQMDTNNDGKLSLEEFIRGAKSDPSIVRLLQCDPSSASQF
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●○○○ 1.27 | 1.26851083994294 | 0.0066 | 31213562 | |
Retrieved 1 of 1 entries in 0.7 ms
(Link to these results)