Host taxon 9606
Protein NP_001191013.1
neuroblastoma suppressor of tumorigenicity 1 isoform 2 precursor
Homo sapiens
Gene NBL1, UniProt P41271
>NP_001191013.1|Haemophilus ducreyi 35000HP|neuroblastoma suppressor of tumorigenicity 1 isoform 2 precursor
MMLRVLVGAVLPAMLLAAPPPINKLALFPDKSAWCEAKNITQIVGHSGCEAKSIQNRACLGQCFSYSVPNTFPQSTESLVHCDSCMPAQSMWEIVTLECPGHEEVPRVDKLVEKILHCSCQACGKEPSHEGLSVYVQGEDGPGSQPGTHPHPHPHPHPGGQTPEPEDPPGAPHTEEEGAED
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●○○○○ -0.79 | -0.793316547685647 | 0.01 | 31213562 | |
Retrieved 1 of 2 entries in 1.6 ms
(Link to these results)