Host taxon 9606
Protein NP_001335058.1
negative regulator of P-body association
Homo sapiens
Gene NBDY, UniProt A0A0U1RRE5
>NP_001335058.1|Haemophilus ducreyi 35000HP|negative regulator of P-body association
MGDQPCASGRSTLPPGNAREAKPPKKRCLLAPRWDYPEGTPNGGSTTLPSAPPPASAGLKSHPPPPEK
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●○○○○ 0.46 | 0.458261038050765 | 0.027 | 31213562 | |
Retrieved 1 of 1 entries in 1.2 ms
(Link to these results)