Host taxon 9606
Protein NP_003960.1
NEDD8-conjugating enzyme Ubc12
Homo sapiens
Gene UBE2M, UniProt P61081
>NP_003960.1|Haemophilus ducreyi 35000HP|NEDD8-conjugating enzyme Ubc12
MIKLFSLKQQKKEEESAGGTKGSSKKASAAQLRIQKDINELNLPKTCDISFSDPDDLLNFKLVICPDEGFYKSGKFVFSFKVGQGYPHDPPKVKCETMVYHPNIDLEGNVCLNILREDWKPVLTINSIIYGLQYLFLEPNPEDPLNKEAAEVLQNNRRLFEQNVQRSMRGGYIGSTYFERCLK
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●○○○○ 0.5 | 0.504214330527375 | 0.041 | 31213562 | |
Retrieved 1 of 2 entries in 0.9 ms
(Link to these results)