Host taxon 9606
Protein NP_001166955.1
nebulette isoform 3
Homo sapiens
Gene NEBL, UniProt O76041
>NP_001166955.1|Haemophilus ducreyi 35000HP|nebulette isoform 3
MNPQCARCGKVVYPTEKVNCLDKYWHKGCFHCEVCKMALNMNNYKGYEKKPYCNAHYPKQSFTTVADTPENLRLKQQSELQSQVKYKRDFEESKGRGFSIVTDTPELQRLKRTQEQISNVKYHEDFEKTKGRGFTPVVDDPVTERVRKNTQVVSDAAYKGVHPHIVEMDRRPGIIVAPVLPGAYQQSHSQGYGYMHQTSVSSMRSMQHSPNLDLPSHVRLQCPG
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●○○○ -1.42 | -1.42346962634578 | 0.00029 | 31213562 | |
Retrieved 1 of 1 entries in 0.9 ms
(Link to these results)