Host taxon 9606
Protein NP_004544.1
NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial precursor
Homo sapiens
Gene NDUFS6, UniProt O75380
>NP_004544.1|Haemophilus ducreyi 35000HP|NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial precursor
MAAAMTFCRLLNRCGEAARSLPLGARCFGVRVSPTGEKVTHTGQVYDDKDYRRIRFVGRQKEVNENFAIDLIAEQPVSEVETRVIACDGGGGALGHPKVYINLDKETKTGTCGYCGLQFRQHHH
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●○○○ 1.27 | 1.27166727267905 | 5.6e-5 | 31213562 | |
Retrieved 1 of 2 entries in 0.7 ms
(Link to these results)