Host taxon 9606
Protein NP_002484.1
NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6 isoform 1
Homo sapiens
Gene NDUFB6, UniProt O95139
>NP_002484.1|Haemophilus ducreyi 35000HP|NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6 isoform 1
MTGYTPDEKLRLQQLRELRRRWLKDQELSPREPVLPPQKMGPMEKFWNKFLENKSPWRKMVHGVYKKSIFVFTHVLVPVWIIHYYMKYHVSEKPYGIVEKKSRIFPGDTILETGEVIPPMKEFPDQHH
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●○○○○ 0.78 | 0.783980804190313 | 0.00035 | 31213562 | |
Retrieved 1 of 2 entries in 0.8 ms
(Link to these results)