Host taxon 9606
Protein NP_001244031.1
NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3
Homo sapiens
Gene NDUFB3, UniProt O43676
>NP_001244031.1|Haemophilus ducreyi 35000HP|NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3
MAHEHGHEHGHHKMELPDYRQWKIEGTPLETIQKKLAAKGLRDPWGRNEAWRYMGGFAKSVSFSDVFFKGFKWGFAAFVVAVGAEYYLESLNKDKKHH
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●○○○ 1.53 | 1.52979037548035 | 1.7e-6 | 31213562 | |
Retrieved 1 of 2 entries in 1.2 ms
(Link to these results)