Host taxon 9606
Protein NP_055037.1
NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 isoform 1
Homo sapiens
Gene NDUFA8, UniProt P51970
>NP_055037.1|Haemophilus ducreyi 35000HP|NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 isoform 1
MPGIVELPTLEELKVDEVKISSAVLKAAAHHYGAQCDKPNKEFMLCRWEEKDPRRCLEEGKLVNKCALDFFRQIKRHCAEPFTEYWTCIDYTGQQLFRHCRKQQAKFDECVLDKLGWVRPDLGELSKVTKVKTDRPLPENPYHSRPRPDPSPEIEGDLQPATHGSRFYFWTK
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●○○○○ 0.76 | 0.762357828927249 | 0.025 | 31213562 | |
Retrieved 1 of 1 entries in 1.6 ms
(Link to these results)