Host taxon 9606
Protein NP_064527.1
NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 4-like 2
Homo sapiens
Gene NDUFA4L2, UniProt Q9NRX3
>NP_064527.1|Haemophilus ducreyi 35000HP|NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 4-like 2
MAGASLGARFYRQIKRHPGIIPMIGLICLGMGSAALYLLRLALRSPDVCWDRKNNPEPWNRLSPNDQYKFLAVSTDYKKLKKDRPDF
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●○○○ 1.35 | 1.35277502763436 | 0.001 | 31213562 | |
Retrieved 1 of 1 entries in 0.9 ms
(Link to these results)