Host taxon 9606
Protein NP_001245267.1
NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 isoform b
Homo sapiens
Gene NDUFA12, UniProt Q9UI09
>NP_001245267.1|Haemophilus ducreyi 35000HP|NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 isoform b
MELVQVLKRGLQQITGHGGLRGYLRVFFRTNDAKVGTLVGEDKYGNKYYEDNKQFFGIVGFTV
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●○○○ 1.14 | 1.13692742480831 | 4.6e-6 | 31213562 | |
Retrieved 1 of 1 entries in 1.2 ms
(Link to these results)