Host taxon 9606
Protein NP_004532.1
NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1
Homo sapiens
Gene NDUFA1, UniProt O15239
>NP_004532.1|Haemophilus ducreyi 35000HP|NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1
MWFEILPGLSVMGVCLLIPGLATAYIHRFTNGGKEKRVAHFGYHWSLMERDRRISGVDRYYVSKGLENID
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●○○○ 1.59 | 1.58554148448757 | 5.2e-6 | 31213562 | |
Retrieved 1 of 1 entries in 0.8 ms
(Link to these results)