Host taxon 9606
Protein NP_004269.1
N-acetylglucosaminyl-phosphatidylinositol de-N-acetylase precursor
Homo sapiens
Gene PIGL, UniProt Q9Y2B2
>NP_004269.1|Haemophilus ducreyi 35000HP|N-acetylglucosaminyl-phosphatidylinositol de-N-acetylase precursor
MEAMWLLCVALAVLAWGFLWVWDSSERMKSREQGGRLGAESRTLLVIAHPDDEAMFFAPTVLGLARLRHWVYLLCFSAGNYYNQGETRKKELLQSCDVLGIPLSSVMIIDNRDFPDDPGMQWDTEHVARVLLQHIEVNGINLVVTFDAGGVSGHSNHIALYAAVRALHSEGKLPKGCSVLTLQSVNVLRKYISLLDLPLSLLHTQDVLFVLNSKEVAQAKKAMSCHRSQLLWFRRLYIIFSRYMRINSLSFL
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●○○○○ -0.94 | -0.93572811783289 | 0.00055 | 31213562 | |
Retrieved 1 of 2 entries in 0.8 ms
(Link to these results)