Host taxon 9606
Protein NP_001166037.2
myeloid differentiation primary response protein MyD88 isoform 5
Homo sapiens
Gene MYD88, UniProt Q99836
>NP_001166037.2|Haemophilus ducreyi 35000HP|myeloid differentiation primary response protein MyD88 isoform 5
MAAGGPGAGSAAPVSSTSSLPLAALNMRVRRRLSLFLNVRTQVAADWTALAEEMDFEYLEIRQLETQADPTGRLLDAWQGRPGASVGRLLELLTKLGRDDVLLELGPSIGAAGWWWLSLMITCRARNVTSRPNLHSASLQVPIRSD
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●●○○ 2.43 | 2.43376731232923 | 6.5e-15 | 31213562 | |
Retrieved 1 of 3 entries in 0.9 ms
(Link to these results)