Host taxon 9606
Protein NP_001164977.1
multiple coagulation factor deficiency protein 2 isoform A precursor
Homo sapiens
Gene MCFD2, UniProt Q8NI22
>NP_001164977.1|Haemophilus ducreyi 35000HP|multiple coagulation factor deficiency protein 2 isoform A precursor
MTMRSLLRTPFLCGLLWAFCAPGARAEEPAASFSQPGSMGLDKNTVHDQEHIMEHLEGVINKPEAEMSPQELQLHYFKMHDYDGNNLLDGLELSTAITHVHKEEGSEQAPLMSEDELINIIDGVLRDDDKNNDGYIDYAEFAKSLQ
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●○○○○ 0.46 | 0.455059527021779 | 0.0056 | 31213562 | |
Retrieved 1 of 1 entries in 1.9 ms
(Link to these results)