Host taxon 9606
Protein NP_001303886.1
mth938 domain-containing protein isoform a
Homo sapiens
Gene AAMDC, UniProt Q9H7C9
>NP_001303886.1|Haemophilus ducreyi 35000HP|mth938 domain-containing protein isoform a
MTSPEIASLSWGQMKVKGSNTTYKDCKVWPGGSRTWDWRETGTEHSPGVQPADVKEVVEKGVQTLVIGRGMSEALKAPTQQLPSGVHVRAVVQFHLATASWHILERCKTGAGLSIKHVCELAMSHLSTFLYQIYDAIILKMHLYFMK
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●○○○○ -0.51 | -0.510326089518606 | 0.0013 | 31213562 | |
Retrieved 1 of 4 entries in 1.9 ms
(Link to these results)